SLC47A2 anticorps (C-Term)

N° du produit ABIN631558

Cet anticorps Lapin Polyclonal détecte spécifiquement SLC47A2 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour SLC47A2 anticorps (C-Term) (ABIN631558)

Antigène: SLC47A2 (Solute Carrier Family 47, Member 2 (SLC47A2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC47A2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SLC47A2 anticorps

Épitope: C-Term

Specificité: SLC47 A2 antibody was raised against the C terminal of SLC47 2

Purification: Affinity purified

Immunogène: SLC47 A2 antibody was raised using the C terminal of SLC47 2 corresponding to a region with amino acids TYSRSECHVDFFRTPEEAHALSAPTSRLSVKQLVIRRGAALGAASATLMV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC47A2 Blocking Peptide, (ABIN5616261), is also available for use as a blocking control in assays to test for specificity of this SLC47A2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC47A2

Antigène: SLC47A2 (Solute Carrier Family 47, Member 2 (SLC47A2))

Autre désignation: SLC47A2

Sujet: SLC47A2 is a protein belonging to a family of transporters involved in excretion of toxic electrolytes, both endogenous and exogenous, through urine and bile. This transporter family shares homology with the bacterial MATE (multidrug and toxin extrusion) protein family responsible for drug resistance.

Poids moléculaire: 61 kDa (MW of target protein)