IGD1 anticorps (Middle Region)

N° du produit ABIN631560

Cet anticorps anti-IGD1 est un anticorps Lapin Polyclonal détectant IGD1 dans WB. Adapté pour Humain.

Aperçu rapide pour IGD1 anticorps (Middle Region) (ABIN631560)

Antigène: IGD1 (IGHD@) (Immunoglobulin Heavy Diversity Cluster (IGHD@))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Application: Western Blotting (WB)

Détail du produit anti-IGD1 anticorps

Épitope: Middle Region

Specificité: TIGD1 antibody was raised against the middle region of TIGD1

Purification: Affinity purified

Immunogène: TIGD1 antibody was raised using the middle region of TIGD1 corresponding to a region with amino acids SQLMRKASPMSYFRKLPQPPQPSAATTLTSQQPSTSRQDPPPAKRVRLTE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TIGD1 Blocking Peptide, (ABIN5616601), is also available for use as a blocking control in assays to test for specificity of this TIGD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TIGD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IGD1

Antigène: IGD1 (IGHD@) (Immunoglobulin Heavy Diversity Cluster (IGHD@))

Autre désignation: IGD1

Sujet: TIGD1 belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function of this protein is not known.

Poids moléculaire: 67 kDa (MW of target protein)