GLO1 anticorps (N-Term)

N° du produit ABIN631567

Détail du produit anti-GLO1 anticorps

Antigène: GLO1 (Glyoxalase I (GLO1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GLO1 est non-conjugé

Application: Western Blotting (WB)

Specificité: GLO1 antibody was raised against the N terminal of GLO1

Purification: Affinity purified

Immunogène: GLO1 antibody was raised using the N terminal of GLO1 corresponding to a region with amino acids TMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GLO1 Blocking Peptide, catalog no. 33R-9204, is also available for use as a blocking control in assays to test for specificity of this GLO1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLO1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GLO1

Antigène: GLO1 (Glyoxalase I (GLO1))

Autre désignation: GLO1 (GLO1 Produits)

Synonymes: anticorps GLOD1, anticorps GLYI, anticorps 0610009E22Rik, anticorps 1110008E19Rik, anticorps 2510049H23Rik, anticorps AW550643, anticorps GLY1, anticorps Glo-1, anticorps Glo-1r, anticorps Glo-1s, anticorps Glo1-r, anticorps Glo1-s, anticorps Qglo, anticorps cb554, anticorps zgc:66035, anticorps wu:fb82g09, anticorps glod1, anticorps glyi, anticorps glo1, anticorps GLO1, anticorps ATGLX1, anticorps F12F1.32, anticorps F12F1_32, anticorps GLYOXALASE I, anticorps glyoxalase I homolog, anticorps trypanothione-dependent glyoxalase I, anticorps glyoxalase I, anticorps glyoxalase 1, anticorps glyoxalase 1 L homeolog, anticorps glyoxalase 1 S homeolog, anticorps lactoylglutathione lyase, anticorps glyoxalase/bleomycin resistance protein/dioxygenase superfamily protein, anticorps GLO1, anticorps Glo1, anticorps glo1, anticorps glo1.L, anticorps glo1.S, anticorps GST3, anticorps GLX1, anticorps STY1687, anticorps Bcen_2094, anticorps gloA

Sujet: The enzyme encoded by this gene is responsible for the catalysis and formation of S-lactoyl-glutathione from methylglyoxal condensation and reduced glutatione. Glyoxalase I is linked to HLA and is localized to 6p21.3-p21.1, between HLA and the centromere.

Poids moléculaire: 21 kDa (MW of target protein)