COG4 anticorps (Middle Region)

N° du produit ABIN631569

Détail du produit anti-COG4 anticorps

Antigène: COG4 (Component of Oligomeric Golgi Complex 4 (COG4))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp COG4 est non-conjugé

Application: Western Blotting (WB)

Specificité: COG4 antibody was raised against the middle region of COG4

Purification: Affinity purified

Immunogène: COG4 antibody was raised using the middle region of COG4 corresponding to a region with amino acids LFSQGIGGEQAQAKFDSCLSDLAAVSNKFRDLLQEGLTELNSTAIKPQVQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

COG4 Blocking Peptide, catalog no. 33R-4949, is also available for use as a blocking control in assays to test for specificity of this COG4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COG4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur COG4

Antigène: COG4 (Component of Oligomeric Golgi Complex 4 (COG4))

Autre désignation: COG4 (COG4 Produits)

Synonymes: anticorps COG4, anticorps DKFZp470I1314, anticorps CDG2J, anticorps COD1, anticorps AW554810, anticorps D8Ertd515e, anticorps zgc:136860, anticorps component of oligomeric golgi complex 4, anticorps COG4, anticorps cog4, anticorps Cog4

Sujet: Multiprotein complexes are key determinants of Golgi apparatus structure and its capacity for intracellular transport and glycoprotein modification. Several complexes have been identified, including the Golgi transport complex (GTC), the LDLC complex, which is involved in glycosylation reactions, and the SEC34 complex, which is involved in vesicular transport. These 3 complexes are identical and have been termed the conserved oligomeric Golgi (COG) complex, which includes COG4.

Poids moléculaire: 89 kDa (MW of target protein)