Keratin 84 anticorps (Middle Region)

N° du produit ABIN631575

Détail du produit anti-Keratin 84 anticorps

Antigène: Keratin 84 (KRT84)

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Keratin 84 est non-conjugé

Application: Western Blotting (WB)

Specificité: Cytokeratin 84 antibody was raised against the middle region of KRT84

Purification: Affinity purified

Immunogène: Cytokeratin 84 antibody was raised using the middle region of KRT84 corresponding to a region with amino acids ESYITNLRRQLEVLVSDQARLQAERNHLQDVLEGFKKKYEEEVVCRANAE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Cytokeratin 84 Blocking Peptide, catalog no. 33R-2754, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 84 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT84 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Keratin 84

Antigène: Keratin 84 (KRT84)

Abstract: KRT84 Produits

Synonymes: anticorps Kb24, anticorps KRT84, anticorps KRTHB4, anticorps HB4, anticorps AV235125, anticorps HRb-1, anticorps Krt2-16, anticorps Krt2-3, anticorps keratin 84, anticorps Krt84, anticorps KRT84

Sujet: The protein encoded by this gene is a member of the keratin gene family. As a type II hair keratin, it is a basic protein which heterodimerizes with type I keratins to form hair and nails.

Poids moléculaire: 65 kDa (MW of target protein)