RPL37A anticorps (Middle Region)

N° du produit ABIN631577

L’anticorps Lapin Polyclonal anti-RPL37A a été validé pour WB. Il convient pour détecter RPL37A dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour RPL37A anticorps (Middle Region) (ABIN631577)

Antigène: RPL37A (Ribosomal Protein L37a (RPL37A))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPL37A est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RPL37A anticorps

Épitope: Middle Region

Specificité: RPL37 A antibody was raised against the middle region of RPL37

Purification: Affinity purified

Immunogène: RPL37 A antibody was raised using the middle region of RPL37 corresponding to a region with amino acids CGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELKD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPL37A Blocking Peptide, (ABIN937089), is also available for use as a blocking control in assays to test for specificity of this RPL37A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPL37A

Antigène: RPL37A (Ribosomal Protein L37a (RPL37A))

Autre désignation: RPL37A

Sujet: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Poids moléculaire: 10 kDa (MW of target protein)