RPL37A anticorps (Middle Region)

N° du produit ABIN631577

Détail du produit anti-RPL37A anticorps

Antigène: RPL37A (Ribosomal Protein L37a (RPL37A))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPL37A est non-conjugé

Application: Western Blotting (WB)

Specificité: RPL37 A antibody was raised against the middle region of RPL37

Purification: Affinity purified

Immunogène: RPL37 A antibody was raised using the middle region of RPL37 corresponding to a region with amino acids CGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELKD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPL37A Blocking Peptide, catalog no. 33R-1703, is also available for use as a blocking control in assays to test for specificity of this RPL37A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPL37A

Antigène: RPL37A (Ribosomal Protein L37a (RPL37A))

Autre désignation: RPL37A (RPL37A Produits)

Synonymes: anticorps L37A, anticorps BcDNA:RE23595, anticorps BcDNA:RH41593, anticorps CG5827, anticorps DmL37a, anticorps Dmel\\CG5827, anticorps M(2)25C, anticorps M(2)S1, anticorps RpL37a, anticorps l(2)25Cb, anticorps CG9091, anticorps Dmel\\CG9091, anticorps RpL37, anticorps RpL37A, anticorps RGD1561181, anticorps Rpl37a, anticorps ribosomal protein L37a, anticorps Ribosomal protein L37A, anticorps ribosomal protein L37a L homeolog, anticorps Ribosomal protein L37a, anticorps ribosomal protein L37a, pseudogene 1, anticorps RPL37A, anticorps Rpl37a, anticorps RpL37A, anticorps rpl37a.L, anticorps RpL37a, anticorps Rpl37a-ps1

Sujet: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Poids moléculaire: 10 kDa (MW of target protein)