RPS13 anticorps (N-Term)

N° du produit ABIN631578

Cet anticorps anti-RPS13 est un anticorps Lapin Polyclonal détectant RPS13 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour RPS13 anticorps (N-Term) (ABIN631578)

Antigène: RPS13 (Ribosomal Protein S13 (RPS13))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPS13 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RPS13 anticorps

Épitope: N-Term

Specificité: RPS13 antibody was raised against the N terminal of RPS13

Purification: Affinity purified

Immunogène: RPS13 antibody was raised using the N terminal of RPS13 corresponding to a region with amino acids MGRMHAPGKGLSQSALPYRRSVPTWLKLTSDDVKEQIYKLAKKGLTPSQI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPS13 Blocking Peptide, (ABIN5615944), is also available for use as a blocking control in assays to test for specificity of this RPS13 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPS13

Antigène: RPS13 (Ribosomal Protein S13 (RPS13))

Autre désignation: RPS13

Sujet: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Poids moléculaire: 17 kDa (MW of target protein)