RPS15 anticorps (Middle Region)

N° du produit ABIN631579

Cet anticorps Lapin Polyclonal détecte spécifiquement RPS15 dans WB. Il présente une réactivité avec des échantillons de Humain, Souris, Rat et C. elegans.

Aperçu rapide pour RPS15 anticorps (Middle Region) (ABIN631579)

Antigène: RPS15 (Ribosomal Protein S15 (RPS15))

Reactivité: Humain, Souris, Rat, C. elegans

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPS15 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RPS15 anticorps

Épitope: Middle Region

Specificité: RPS15 antibody was raised against the middle region of RPS15

Purification: Affinity purified

Immunogène: RPS15 antibody was raised using the middle region of RPS15 corresponding to a region with amino acids GVYNGKTFNQVEIKPEMIGHYLGEFSITYKPVKHGRPGIGATHSSRFIPL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPS15 Blocking Peptide, (ABIN939048), is also available for use as a blocking control in assays to test for specificity of this RPS15 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS15 antibody in PBS

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPS15

Antigène: RPS15 (Ribosomal Protein S15 (RPS15))

Autre désignation: RPS15

Sujet: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Poids moléculaire: 17 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly