RPS15A anticorps (Middle Region)
-
- Antigène Voir toutes RPS15A (RA) Anticorps
- RPS15A (RA) (Ribosomal Protein S15a (RA))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RPS15A est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RPS15 A antibody was raised against the middle region of RPS15
- Purification
- Affinity purified
- Immunogène
- RPS15 A antibody was raised using the middle region of RPS15 corresponding to a region with amino acids KCGVISPRFDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGIMDHEEARRKH
- Top Product
- Discover our top product RA Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RPS15A Blocking Peptide, catalog no. 33R-4269, is also available for use as a blocking control in assays to test for specificity of this RPS15A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RPS15A (RA) (Ribosomal Protein S15a (RA))
- Autre désignation
- RPS15A (RA Produits)
- Sujet
- Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit.
- Poids moléculaire
- 15 kDa (MW of target protein)
-