SCP2 anticorps (Middle Region)

N° du produit ABIN631588

Détail du produit anti-SCP2 anticorps

Antigène: SCP2 (Sterol Carrier Protein 2 (SCP2))

Épitope: Middle Region

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SCP2 est non-conjugé

Application: Western Blotting (WB)

Specificité: SCP2 antibody was raised against the middle region of SCP2

Purification: Affinity purified

Immunogène: SCP2 antibody was raised using the middle region of SCP2 corresponding to a region with amino acids NHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SCP2 Blocking Peptide, catalog no. 33R-6715, is also available for use as a blocking control in assays to test for specificity of this SCP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SCP2

Antigène: SCP2 (Sterol Carrier Protein 2 (SCP2))

Autre désignation: SCP2 (SCP2 Produits)

Synonymes: anticorps NLTP, anticorps NSL-TP, anticorps SCP-2, anticorps SCP-CHI, anticorps SCP-X, anticorps SCPX, anticorps AA409774, anticorps AA409893, anticorps C76618, anticorps C79031, anticorps ns-LTP, anticorps NSLIPTR, anticorps SCPx, anticorps MGC77634, anticorps zgc:77634, anticorps SCP2, anticorps MGC108409, anticorps ATSCP2, anticorps MBD2.8, anticorps MBD2_8, anticorps STEROL CARRIER PROTEIN 2, anticorps PLTP, anticorps zgc:101621, anticorps sterol carrier protein 2, anticorps sterol carrier protein 2, liver, anticorps sterol carrier protein 2a, anticorps sterol carrier protein 2 L homeolog, anticorps phospholipid transfer protein homolog1, anticorps uncharacterized LOC101116445, anticorps sterol carrier protein 2b, anticorps SCP2, anticorps Scp2, anticorps scp2a, anticorps scp2.L, anticorps scp2, anticorps CC1G_13192, anticorps plt1, anticorps LOC101116445, anticorps scp2b

Sujet: SCP2 protein is thought to be an intracellular lipid transfer protein. SCP2 is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis.

Poids moléculaire: 35 kDa (MW of target protein)

Pathways: C21-Steroid Hormone Metabolic Process, Monocarboxylic Acid Catabolic Process