CENPQ anticorps (N-Term)

N° du produit ABIN631590

Cet anticorps anti-CENPQ est un anticorps Lapin Polyclonal détectant CENPQ dans WB. Adapté pour Humain.

Aperçu rapide pour CENPQ anticorps (N-Term) (ABIN631590)

Antigène: CENPQ (Centromere Protein Q (CENPQ))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CENPQ est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CENPQ anticorps

Épitope: N-Term

Specificité: CENPQ antibody was raised against the N terminal of CENPQ

Purification: Affinity purified

Immunogène: CENPQ antibody was raised using the N terminal of CENPQ corresponding to a region with amino acids VRNTVKKNKNHLKDLSSEGQTKHTNLKHGKTAASKRKTWQPLSKSTRDHL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CENPQ Blocking Peptide, (ABIN5612822), is also available for use as a blocking control in assays to test for specificity of this CENPQ antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CENPQ antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CENPQ

Antigène: CENPQ (Centromere Protein Q (CENPQ))

Autre désignation: CENPQ

Sujet: CENPQ is a subunit of a CENPH-CENPI-associated centromeric complex that targets CENPA to centromeres and is required for proper kinetochore function and mitotic progression.

Poids moléculaire: 30 kDa (MW of target protein)