Catalase anticorps (Middle Region)

N° du produit ABIN631595

Détail du produit anti-Catalase anticorps

Antigène: Catalase (CAT)

Épitope: Middle Region

Reactivité: Humain, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Catalase est non-conjugé

Application: Western Blotting (WB)

Specificité: Catalase antibody was raised against the middle region of CAT

Purification: Affinity purified

Immunogène: Catalase antibody was raised using the middle region of CAT corresponding to a region with amino acids LKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Catalase Blocking Peptide, catalog no. 33R-5077, is also available for use as a blocking control in assays to test for specificity of this Catalase antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Références pour anticorps anti-Catalase (ABIN631595)

Makkar, Contreras, Paintlia, Smith, Haq, Singh: "Molecular organization of peroxisomal enzymes: protein-protein interactions in the membrane and in the matrix." dans: Archives of biochemistry and biophysics, Vol. 451, Issue 2, pp. 128-40, (2006) (PubMed).

Détails sur Catalase

Antigène: Catalase (CAT)

Autre désignation: Catalase (CAT Produits)

Synonymes: anticorps 2210418N07, anticorps Cas-1, anticorps Cas1, anticorps Cs-1, anticorps CS1, anticorps Cat01, anticorps Catl, anticorps fb68a12, anticorps wu:fb68a12, anticorps CAT, anticorps CATA, anticorps CG6871, anticorps CT21282, anticorps CatA, anticorps DMCATHPO, anticorps DROCATHPO, anticorps Dmel\\CG6871, anticorps U00145, anticorps bs36h11.y1, anticorps cat, anticorps GB11648, anticorps catalase, anticorps Cat, anticorps BA0843, anticorps DKFZp469E0232, anticorps catalase, anticorps Catalase, anticorps catalase, gene 2, anticorps CAT, anticorps Cat, anticorps cat, anticorps cat.2, anticorps LOC769804, anticorps BA_0843

Sujet: This gene encodes catalase, a key antioxidant enzyme in the bodies defense against oxidative stress. Catalase is a heme enzyme that is present in the peroxisome of nearly all aerobic cells.

Poids moléculaire: 58 kDa (MW of target protein)

Pathways: Cellular Glucan Metabolic Process, Cell RedoxHomeostasis, Photoperiodism