KPTN anticorps

N° du produit ABIN631596

Détail du produit anti-KPTN anticorps

Antigène: KPTN (Kaptin (Actin Binding Protein) (KPTN))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KPTN est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Kaptin antibody was raised using a synthetic peptide corresponding to a region with amino acids MGEAAVAAGPCPLREDSFTRFSSQSNVYGLAGGAGGRGELLAATLKGKVL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Kaptin Blocking Peptide, catalog no. 33R-6017, is also available for use as a blocking control in assays to test for specificity of this Kaptin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KPTN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KPTN

Antigène: KPTN (Kaptin (Actin Binding Protein) (KPTN))

Autre désignation: Kaptin (KPTN Produits)

Synonymes: anticorps 2310042D10Rik, anticorps 2E4, anticorps C030013F01Rik, anticorps wu:fc13b08, anticorps wu:fc13b09, anticorps zgc:100793, anticorps kaptin, actin binding protein, anticorps kaptin, anticorps kaptin (actin binding protein), anticorps kaptin (actin binding protein) L homeolog, anticorps kptn, anticorps Kptn, anticorps KPTN, anticorps kptn.L

Sujet: KPTN may be involved in actin dynamics. KPTN may play a role in producing the sensory apparatus in hair cells. KPTN may also play a role in actin rearrangements that accompany platelet activation and stereocilia formation.

Poids moléculaire: 47 kDa (MW of target protein)

Pathways: Sensory Perception of Sound