Vimentin anticorps (N-Term)
-
- Antigène Voir toutes Vimentin (VIM) Anticorps
- Vimentin (VIM)
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Vimentin est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Vimentin antibody was raised against the N terminal of VIM
- Purification
- Affinity purified
- Immunogène
- Vimentin antibody was raised using the N terminal of VIM corresponding to a region with amino acids LNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRR
- Top Product
- Discover our top product VIM Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Vimentin Blocking Peptide, catalog no. 33R-5218, is also available for use as a blocking control in assays to test for specificity of this Vimentin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VIM antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Vimentin (VIM)
- Autre désignation
- Vimentin (VIM Produits)
- Synonymes
- anticorps CTRCT30, anticorps cb28, anticorps vime, anticorps vim, anticorps vim1, anticorps vim2, anticorps VIM, anticorps Vimentin, anticorps vim4, anticorps vimentin, anticorps vimentin L homeolog, anticorps vimentin S homeolog, anticorps VIM, anticorps Vim, anticorps vim, anticorps vim.L, anticorps vim.S
- Sujet
- Along with the microfilaments (actins) and microtubules (tubulins), the intermediate filaments represent a third class of well-characterized cytoskeletal elements. The subunits display a tissue-specific pattern of expression. Desmin is the subunit specific for muscle and vimentin the subunit specific for mesenchymal tissue.
- Poids moléculaire
- 54 kDa (MW of target protein)
- Pathways
- Caspase Cascade in Apoptosis
-