Cytokeratin 19 anticorps (N-Term)

N° du produit ABIN631608

Cet anticorps anti-Cytokeratin 19 est un anticorps Lapin Polyclonal détectant Cytokeratin 19 dans WB. Adapté pour Humain.

Aperçu rapide pour Cytokeratin 19 anticorps (N-Term) (ABIN631608)

Antigène: Cytokeratin 19 (KRT19) (Keratin 19 (KRT19))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Cytokeratin 19 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Cytokeratin 19 anticorps

Épitope: N-Term

Specificité: Cytokeratin 19 antibody was raised against the N terminal of KRT19

Purification: Affinity purified

Immunogène: Cytokeratin 19 antibody was raised using the N terminal of KRT19 corresponding to a region with amino acids LEVKIRDWYQKQGPGPSRDYSHYYTTIQDLRDKILGATIENSRIVLQIDN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Cytokeratin 19 Blocking Peptide, (ABIN940318), is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 19 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT19 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Cytokeratin 19

Antigène: Cytokeratin 19 (KRT19) (Keratin 19 (KRT19))

Autre désignation: Cytokeratin 19

Sujet: KRT19 is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. Unlike its related family members, this smallest known acidic cytokeratin is not paired with a basic cytokeratin in epithelial cells. It is specifically expressed in the periderm, the transiently superficial layer that envelopes the developing epidermis.

Poids moléculaire: 44 kDa (MW of target protein)