Keratin 75 anticorps (Middle Region)

N° du produit ABIN631612

Détail du produit anti-Keratin 75 anticorps

Antigène: Keratin 75 (KRT75)

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Keratin 75 est non-conjugé

Application: Western Blotting (WB)

Specificité: Cytokeratin 75 antibody was raised against the middle region of KRT75

Purification: Affinity purified

Immunogène: Cytokeratin 75 antibody was raised using the middle region of KRT75 corresponding to a region with amino acids SFTTSGGHSLGAGLGGSGFSATSNRGLGGSGSSVKFVSTTSSSQKSYTH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Cytokeratin 75 Blocking Peptide, catalog no. 33R-8442, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 75 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT75 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Keratin 75

Antigène: Keratin 75 (KRT75)

Autre désignation: Cytokeratin 75 (KRT75 Produits)

Synonymes: anticorps KRT75, anticorps K6HF, anticorps KB18, anticorps PFB, anticorps 4732468K03Rik, anticorps AA589387, anticorps K6hf, anticorps Krt2-6hf, anticorps Krtcap1, anticorps Kb18, anticorps keratin 75, anticorps keratin, type II cytoskeletal 75, anticorps keratin, type II cytoskeletal 6A, anticorps KRT75, anticorps LOC466991, anticorps LOC100566287, anticorps Krt75

Sujet: This gene is a member of the type II keratin family clustered on the long arm of chromosome 12. Type I and type II keratins heteropolymerize to form intermediate-sized filaments in the cytoplasm of epithelial cells.

Poids moléculaire: 59 kDa (MW of target protein)