PDAP1 anticorps (N-Term)
-
- Antigène Voir toutes PDAP1 Anticorps
- PDAP1 (PDGFA Associated Protein 1 (PDAP1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PDAP1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PDAP1 antibody was raised against the N terminal of PDAP1
- Purification
- Affinity purified
- Immunogène
- PDAP1 antibody was raised using the N terminal of PDAP1 corresponding to a region with amino acids MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGD
- Top Product
- Discover our top product PDAP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PDAP1 Blocking Peptide, catalog no. 33R-6287, is also available for use as a blocking control in assays to test for specificity of this PDAP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDAP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PDAP1 (PDGFA Associated Protein 1 (PDAP1))
- Autre désignation
- PDAP1 (PDAP1 Produits)
- Synonymes
- anticorps pdap1, anticorps zgc:56213, anticorps HASPP28, anticorps PAP, anticorps PAP1, anticorps Haspp28, anticorps pdgfa associated protein 1b, anticorps 28 kDa heat- and acid-stable phosphoprotein, anticorps PDGFA associated protein 1, anticorps pdap1b, anticorps CpipJ_CPIJ013582, anticorps PDAP1, anticorps Pdap1
- Sujet
- PDAP1 enhances PDGFA-stimulated cell growth in fibroblasts, but inhibits the mitogenic effect of PDGFB.
- Poids moléculaire
- 20 kDa (MW of target protein)
- Pathways
- Platelet-derived growth Factor Receptor Signaling
-