EEF1A2 anticorps (Middle Region)

N° du produit ABIN631619

Détail du produit anti-EEF1A2 anticorps

Antigène: EEF1A2 (Eukaryotic Translation Elongation Factor 1 alpha 2 (EEF1A2))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EEF1A2 est non-conjugé

Application: Western Blotting (WB)

Specificité: EEF1 A2 antibody was raised against the middle region of EEF1 2

Purification: Affinity purified

Immunogène: EEF1 A2 antibody was raised using the middle region of EEF1 2 corresponding to a region with amino acids VIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EEF1A2 Blocking Peptide, catalog no. 33R-9588, is also available for use as a blocking control in assays to test for specificity of this EEF1A2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EEF0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EEF1A2

Antigène: EEF1A2 (Eukaryotic Translation Elongation Factor 1 alpha 2 (EEF1A2))

Autre désignation: EEF1A2 (EEF1A2 Produits)

Synonymes: anticorps EEF1AL, anticorps EF-1-alpha-2, anticorps EF1A, anticorps HS1, anticorps STN, anticorps STNL, anticorps EEF1A2, anticorps Eef1a, anticorps S1, anticorps wasted, anticorps wst, anticorps Ps10, anticorps RATPS10, anticorps Stnl, anticorps eef1al, anticorps ef1a, anticorps stnl, anticorps EEF1A-2, anticorps zgc:92085, anticorps eukaryotic translation elongation factor 1 alpha 2, anticorps eukaryotic translation elongation factor 1 alpha 1, anticorps eukaryotic translation elongation factor 1 alpha 2 S homeolog, anticorps putative elongation factor 1-alpha-like 3, anticorps EEF1A2, anticorps EEF1A1, anticorps Eef1a2, anticorps eef1a2.S, anticorps eef1a2, anticorps LOC739210, anticorps EEF1, anticorps eef1

Sujet: EEF1A2 is an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 2) is expressed in brain, heart and skeletal muscle, and the other isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas. This gene may be critical in the development of ovarian cancer. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Poids moléculaire: 50 kDa (MW of target protein)