MAB21L1 anticorps

N° du produit ABIN631621

Cet anticorps Lapin Polyclonal détecte spécifiquement MAB21L1 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour MAB21L1 anticorps (ABIN631621)

Antigène: MAB21L1 (Mab-21-Like 1 (MAB21L1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAB21L1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MAB21L1 anticorps

Purification: Affinity purified

Immunogène: MAB21 L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids IAAQAKLVYHLNKYYNEKCQARKAAIAKTIREVCKVVSDVLKEVEVQEPR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAB21L1 Blocking Peptide, (ABIN939273), is also available for use as a blocking control in assays to test for specificity of this MAB21L1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAB20 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAB21L1

Antigène: MAB21L1 (Mab-21-Like 1 (MAB21L1))

Autre désignation: MAB21L1

Sujet: This gene is similar to the MAB-21 cell fate-determining gene found in C. elegans. It may be involved in eye and cerebellum development, and it has been proposed that expansion of a trinucleotide repeat region in the 5' UTR may play a role in a variety of psychiatric disorders.

Poids moléculaire: 41 kDa (MW of target protein)