MBOAT1 anticorps (N-Term)

N° du produit ABIN631638

Cet anticorps anti-MBOAT1 est un anticorps Lapin Polyclonal détectant MBOAT1 dans WB. Adapté pour Humain.

Aperçu rapide pour MBOAT1 anticorps (N-Term) (ABIN631638)

Antigène: MBOAT1 (Membrane Bound O-Acyltransferase Domain Containing 1 (MBOAT1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MBOAT1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MBOAT1 anticorps

Épitope: N-Term

Specificité: MBOAT1 antibody was raised against the N terminal of MBOAT1

Purification: Affinity purified

Immunogène: MBOAT1 antibody was raised using the N terminal of MBOAT1 corresponding to a region with amino acids AAEPQPSSLSYRTTGSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MBOAT1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this MBOAT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MBOAT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MBOAT1

Antigène: MBOAT1 (Membrane Bound O-Acyltransferase Domain Containing 1 (MBOAT1))

Autre désignation: MBOAT1

Sujet: MBOAT1 shares structural similarity with a superfamily of membrane-bound O-acetyltransferases that transfer organic compounds, usually fatty acids (e.g., cholesterol, diacylglycerol, palmitoyl), onto hydroxyl groups of membrane-embedded targets.

Poids moléculaire: 56 kDa (MW of target protein)