SELENBP1 anticorps (C-Term)

N° du produit ABIN631644

Cet anticorps anti-SELENBP1 est un anticorps Lapin Polyclonal détectant SELENBP1 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour SELENBP1 anticorps (C-Term) (ABIN631644)

Antigène: SELENBP1 (Selenium Binding Protein 1 (SELENBP1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SELENBP1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SELENBP1 anticorps

Épitope: C-Term

Specificité: SELENBP1 antibody was raised against the C terminal of SELENBP1

Purification: Affinity purified

Immunogène: SELENBP1 antibody was raised using the C terminal of SELENBP1 corresponding to a region with amino acids KQFYPDLIREGSVMLQVDVDTVKGGLKLNPNFLVDFGKEPLGPALAHELR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SELENBP1 Blocking Peptide, (ABIN939990), is also available for use as a blocking control in assays to test for specificity of this SELENBP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SELENBP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SELENBP1

Antigène: SELENBP1 (Selenium Binding Protein 1 (SELENBP1))

Autre désignation: SELENBP1

Sujet: SELENBP1 belongs to the selenium-binding protein family. Selenium is an essential nutrient that exhibits potent anticarcinogenic properties, and deficiency of selenium may cause certain neurologic diseases. It has been proposed that the effects of selenium in preventing cancer and neurologic diseases may be mediated by selenium-binding proteins.

Poids moléculaire: 44 kDa (MW of target protein)

Pathways: Brown Fat Cell Differentiation