WDR34 anticorps (C-Term)

N° du produit ABIN631651

Cet anticorps Lapin Polyclonal détecte spécifiquement WDR34 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour WDR34 anticorps (C-Term) (ABIN631651)

Antigène: WDR34 (WD Repeat Domain 34 (WDR34))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WDR34 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-WDR34 anticorps

Épitope: C-Term

Specificité: WDR34 antibody was raised against the C terminal of WDR34

Purification: Affinity purified

Immunogène: WDR34 antibody was raised using the C terminal of WDR34 corresponding to a region with amino acids SLKYLFAVRWSPVRPLVFAAASGKGDVQLFDLQKSSQKPTVLIKQTQDES

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WDR34 Blocking Peptide, (ABIN5616996), is also available for use as a blocking control in assays to test for specificity of this WDR34 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR34 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WDR34

Antigène: WDR34 (WD Repeat Domain 34 (WDR34))

Autre désignation: WDR34

Sujet: WDR34 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.

Poids moléculaire: 58 kDa (MW of target protein)