UBE2D3 anticorps

N° du produit ABIN631661

Détail du produit anti-UBE2D3 anticorps

Antigène: UBE2D3 (Ubiquitin-Conjugating Enzyme E2D 3 (UBE2D3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UBE2D3 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: UBE2 D3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UBE2D3 Blocking Peptide, catalog no. 33R-5691, is also available for use as a blocking control in assays to test for specificity of this UBE2D3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UBE2D3

Antigène: UBE2D3 (Ubiquitin-Conjugating Enzyme E2D 3 (UBE2D3))

Autre désignation: UBE2D3 (UBE2D3 Produits)

Synonymes: anticorps E2(17)KB3, anticorps UBC4/5, anticorps UBCH5C, anticorps eff, anticorps fb36f02, anticorps wu:fb36f02, anticorps zgc:56340, anticorps 1100001F19Rik, anticorps 9430029A22Rik, anticorps AA414951, anticorps UBE2D3P, anticorps Xubc4, anticorps e2(17)kb3, anticorps ubc4/5, anticorps ubch5c, anticorps ube2d3.1, anticorps ube2d2, anticorps xubc4, anticorps wu:fj13d01, anticorps zgc:73200, anticorps ubiquitin conjugating enzyme E2 D3, anticorps ubiquitin-conjugating enzyme E2D 3, anticorps ubiquitin conjugating enzyme E2 D3 L homeolog, anticorps ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast), like, anticorps UBE2D3, anticorps ube2d3, anticorps Ube2d3, anticorps LOC100223566, anticorps ube2d3.L, anticorps ube2d2l

Sujet: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2D3 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase.

Poids moléculaire: 17 kDa (MW of target protein)

Pathways: Activation of Innate immune Response, Toll-Like Receptors Cascades