PCGF5 anticorps (N-Term)

N° du produit ABIN631667

L’anticorps Lapin Polyclonal anti-PCGF5 a été validé pour WB. Il convient pour détecter PCGF5 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour PCGF5 anticorps (N-Term) (ABIN631667)

Antigène: PCGF5 (Polycomb Group Ring Finger 5 (PCGF5))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCGF5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PCGF5 anticorps

Épitope: N-Term

Specificité: PCGF5 antibody was raised against the N terminal of PCGF5

Purification: Affinity purified

Immunogène: PCGF5 antibody was raised using the N terminal of PCGF5 corresponding to a region with amino acids ATQRKHLVKDFNPYITCYICKGYLIKPTTVTECLHTFCKTCIVQHFEDSN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCGF5 Blocking Peptide, (ABIN936957), is also available for use as a blocking control in assays to test for specificity of this PCGF5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCGF5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PCGF5

Antigène: PCGF5 (Polycomb Group Ring Finger 5 (PCGF5))

Autre désignation: PCGF5

Sujet: PCGF5 contains 1 RING-type zinc finger. It is probable component of some Polycomb group (PcG) multiprotein complex, a complex required to maintain the transcriptionally repressive state of some genes.

Poids moléculaire: 30 kDa (MW of target protein)