PDZK1 anticorps (N-Term)

N° du produit ABIN631670

L’anticorps Lapin Polyclonal anti-PDZK1 a été validé pour WB. Il convient pour détecter PDZK1 dans des échantillons de Humain et Souris.

Aperçu rapide pour PDZK1 anticorps (N-Term) (ABIN631670)

Antigène: PDZK1 (PDZ Domain Containing 1 (PDZK1))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PDZK1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PDZK1 anticorps

Épitope: N-Term

Specificité: PDZK1 antibody was raised against the n terminal of PDZK1

Purification: Affinity purified

Immunogène: PDZK1 antibody was raised using the N terminal of PDZK1 corresponding to a region with amino acids MTSTFNPRECKLSKQEGQNYGFFLRIEKDTEGHLVRVVEKCSPAEKAGLQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PDZK1 Blocking Peptide, (ABIN5615301), is also available for use as a blocking control in assays to test for specificity of this PDZK1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDZK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PDZK1

Antigène: PDZK1 (PDZ Domain Containing 1 (PDZK1))

Autre désignation: PDZK1

Sujet: PDZK1 is a scaffold protein that connects plasma membrane proteins and regulatory components, regulating their surface expression in epithelial cells apical domains. It may be involved in the coordination of a diverse range of regulatory processes for ion transport and second messenger cascades. In complex with SLC9A3R1, it may cluster proteins that are functionally dependent in a mutual fashion and modulate the trafficking and the activity of the associated membrane proteins.

Poids moléculaire: 41 kDa (MW of target protein)