HAO1 anticorps

N° du produit ABIN631675

Cet anticorps Lapin Polyclonal détecte spécifiquement HAO1 dans WB. Il présente une réactivité envers Humain, Souris, Rat, Chien et Poisson zèbre (Danio rerio).

Aperçu rapide pour HAO1 anticorps (ABIN631675)

Antigène: HAO1 (Hydroxyacid Oxidase (Glycolate Oxidase) 1 (HAO1))

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HAO1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HAO1 anticorps

Purification: Affinity purified

Immunogène: HAO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HAO1 Blocking Peptide, (ABIN938797), is also available for use as a blocking control in assays to test for specificity of this HAO1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAO1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HAO1

Antigène: HAO1 (Hydroxyacid Oxidase (Glycolate Oxidase) 1 (HAO1))

Autre désignation: HAO1

Sujet: Subcellular location of HAO1 is the peroxisome. Specifically, HAO1 is expressed primarily in liver and pancreas and is most active on glycolate, a two-carbon substrate. The protein is also active on 2-hydroxy fatty acids.

Poids moléculaire: 41 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process