PES1 anticorps

N° du produit ABIN631680

Détail du produit anti-PES1 anticorps

Antigène: PES1 (Pescadillo Ribosomal Biogenesis Factor 1 (PES1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PES1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PES1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKREKYLYQKIMFGKRRKIREANKLAEKRKAHDEAVRSEKKAKKARPE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PES1 Blocking Peptide, catalog no. 33R-4489, is also available for use as a blocking control in assays to test for specificity of this PES1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PES1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PES1

Antigène: PES1 (Pescadillo Ribosomal Biogenesis Factor 1 (PES1))

Autre désignation: PES1 (PES1 Produits)

Synonymes: anticorps PES, anticorps pes, anticorps pes1, anticorps pescadillo ribosomal biogenesis factor 1, anticorps pescadillo ribosomal biogenesis factor 1 S homeolog, anticorps Pescadillo, anticorps PES1, anticorps Pes1, anticorps pes1.S, anticorps pesc

Sujet: PES1 is abnormally elevated in malignant tumors of astrocytic origin. It is a strongly conserved gene containing a BRCT domain that is essential for the activity of this gene product. The gene plays a crucial role in cell proliferation and may be necessary for oncogenic transformation and tumor progression.

Poids moléculaire: 68 kDa (MW of target protein)