ERI2 anticorps (N-Term)

N° du produit ABIN631685

Détail du produit anti-ERI2 anticorps

Antigène: ERI2 (EXOD1) (ERI1 Exoribonuclease Family Member 2 (EXOD1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ERI2 est non-conjugé

Application: Western Blotting (WB)

Specificité: EXOD1 antibody was raised against the N terminal Of Exod1

Purification: Affinity purified

Immunogène: EXOD1 antibody was raised using the N terminal Of Exod1 corresponding to a region with amino acids GQIDSEFQAYVQPQEHPILSEFCMELTGIKQAQVDEGVPLKICLSQFCKW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EXOD1 Blocking Peptide, catalog no. 33R-3497, is also available for use as a blocking control in assays to test for specificity of this EXOD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ERI2

Antigène: ERI2 (EXOD1) (ERI1 Exoribonuclease Family Member 2 (EXOD1))

Autre désignation: EXOD1 (EXOD1 Produits)

Synonymes: anticorps exod1, anticorps EXOD1, anticorps Exod1, anticorps 4933424N09Rik, anticorps mKIAA1504, anticorps eri2, anticorps ERI1 exoribonuclease family member 2 L homeolog, anticorps ERI1 exoribonuclease family member 2, anticorps exoribonuclease 2, anticorps eri2.L, anticorps ERI2, anticorps Eri2, anticorps eri2

Sujet: EXOD1 belongs to the EXOD1 family. It contains 1 exonuclease domain. EXOD1 is a member of a new subclass of exonucleases called the 3'hExo/ERI-1 subfamily of DEDDh nucleases.

Poids moléculaire: 37 kDa (MW of target protein)