NT5DC1 anticorps (N-Term)

N° du produit ABIN631687

Cet anticorps Lapin Polyclonal détecte spécifiquement NT5DC1 dans WB. Il présente une réactivité envers Humain et Souris.

Aperçu rapide pour NT5DC1 anticorps (N-Term) (ABIN631687)

Antigène: NT5DC1 (5'-Nucleotidase Domain Containing 1 (NT5DC1))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NT5DC1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-NT5DC1 anticorps

Épitope: N-Term

Specificité: NT5 DC1 antibody was raised against the N terminal of NT5 C1

Purification: Affinity purified

Immunogène: NT5 DC1 antibody was raised using the N terminal of NT5 C1 corresponding to a region with amino acids EWKHFLSDTGMACRSGKYYFYDNYFDLPGALLCARVVDYLTKLNNGQKTF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NT5DC1 Blocking Peptide, (ABIN938197), is also available for use as a blocking control in assays to test for specificity of this NT5DC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NT0 C1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NT5DC1

Antigène: NT5DC1 (5'-Nucleotidase Domain Containing 1 (NT5DC1))

Autre désignation: NT5DC1

Sujet: While the exact function of the protein encoded by this gene is not known, it belongs to the 5'(3')-deoxyribonucleotidase family.

Poids moléculaire: 52 kDa (MW of target protein)