TTC9C anticorps (N-Term)

N° du produit ABIN631689

Détail du produit anti-TTC9C anticorps

Antigène: TTC9C (Tetratricopeptide Repeat Domain 9C (TTC9C))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TTC9C est non-conjugé

Application: Western Blotting (WB)

Specificité: TTC9 C antibody was raised against the N terminal of TTC9

Purification: Affinity purified

Immunogène: TTC9 C antibody was raised using the N terminal of TTC9 corresponding to a region with amino acids MEKRLQEAQLYKEEGNQRYREGKYRDAVSRYHRALLQLRGLDPSLPSPLP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TTC9C Blocking Peptide, catalog no. 33R-5931, is also available for use as a blocking control in assays to test for specificity of this TTC9C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TTC9C

Antigène: TTC9C (Tetratricopeptide Repeat Domain 9C (TTC9C))

Autre désignation: TTC9C (TTC9C Produits)

Synonymes: anticorps MGC56497, anticorps zgc:56497, anticorps im:7142077, anticorps 2210019E14Rik, anticorps 6330408J23Rik, anticorps RGD1359253, anticorps tetratricopeptide repeat domain 9C, anticorps ttc9c, anticorps TTC9C, anticorps Ttc9c

Sujet: The function of TTC9C protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 20 kDa (MW of target protein)