CIB3 anticorps (N-Term)

N° du produit ABIN631697

Détail du produit anti-CIB3 anticorps

Antigène: CIB3 (Calcium and Integrin Binding Protein 3 (CIB3))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CIB3 est non-conjugé

Application: Western Blotting (WB)

Specificité: CIB3 antibody was raised against the N terminal of CIB3

Purification: Affinity purified

Immunogène: CIB3 antibody was raised using the N terminal of CIB3 corresponding to a region with amino acids QDLAPQLVPLDYTTCPDVKVPYELIGSMPELKDNPFRQRIAQVFSEDGDG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CIB3 Blocking Peptide, catalog no. 33R-7504, is also available for use as a blocking control in assays to test for specificity of this CIB3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CIB3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CIB3

Antigène: CIB3 (Calcium and Integrin Binding Protein 3 (CIB3))

Autre désignation: CIB3 (CIB3 Produits)

Synonymes: anticorps C730014M21Rik, anticorps Gm1107, anticorps KIP3, anticorps calcium and integrin binding family member 3, anticorps Cib3, anticorps CIB3, anticorps cib3

Sujet: The specific function of CIB3 is not yet known.

Poids moléculaire: 22 kDa (MW of target protein)