NEDD1 anticorps (N-Term)

N° du produit ABIN631703

L’anticorps Lapin Polyclonal anti-NEDD1 a été validé pour WB. Il convient pour détecter NEDD1 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour NEDD1 anticorps (N-Term) (ABIN631703)

Antigène: NEDD1 (Neural Precursor Cell Expressed, Developmentally Down-Regulated 1 (NEDD1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NEDD1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-NEDD1 anticorps

Épitope: N-Term

Specificité: NEDD1 antibody was raised against the N terminal of NEDD1

Purification: Affinity purified

Immunogène: NEDD1 antibody was raised using the N terminal of NEDD1 corresponding to a region with amino acids MQENLRFASSGDDIKIWDASSMTLVDKFNPHTSPHGISSICWSSNNNFLV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NEDD1 Blocking Peptide, (ABIN5614951), is also available for use as a blocking control in assays to test for specificity of this NEDD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEDD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NEDD1

Antigène: NEDD1 (Neural Precursor Cell Expressed, Developmentally Down-Regulated 1 (NEDD1))

Autre désignation: NEDD1

Sujet: NEDD1 is required for mitosis progression. NEDD1 promotes the nucleation of microtubules from the spindle.

Poids moléculaire: 72 kDa (MW of target protein)

Pathways: M Phase