BPNT1 anticorps
-
- Antigène Voir toutes BPNT1 Anticorps
- BPNT1 (3'(2'), 5'-Bisphosphate Nucleotidase 1 (BPNT1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp BPNT1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- BPNT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIP
- Top Product
- Discover our top product BPNT1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
BPNT1 Blocking Peptide, catalog no. 33R-2153, is also available for use as a blocking control in assays to test for specificity of this BPNT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BPNT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- BPNT1 (3'(2'), 5'-Bisphosphate Nucleotidase 1 (BPNT1))
- Autre désignation
- BPNT1 (BPNT1 Produits)
- Synonymes
- anticorps BPNT1, anticorps PIP, anticorps Sal3, anticorps BPntase, anticorps 3'(2'), 5'-bisphosphate nucleotidase 1, anticorps bisphosphate 3'-nucleotidase 1, anticorps BPNT1, anticorps bpnt1.L, anticorps Bpnt1
- Sujet
- BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity.
- Poids moléculaire
- 29 kDa (MW of target protein)
- Pathways
- Inositol Metabolic Process
-