BPNT1 anticorps

N° du produit ABIN631707

Détail du produit anti-BPNT1 anticorps

Antigène: BPNT1 (3'(2'), 5'-Bisphosphate Nucleotidase 1 (BPNT1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BPNT1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: BPNT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BPNT1 Blocking Peptide, catalog no. 33R-2153, is also available for use as a blocking control in assays to test for specificity of this BPNT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BPNT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BPNT1

Antigène: BPNT1 (3'(2'), 5'-Bisphosphate Nucleotidase 1 (BPNT1))

Autre désignation: BPNT1 (BPNT1 Produits)

Synonymes: anticorps BPNT1, anticorps PIP, anticorps Sal3, anticorps BPntase, anticorps 3'(2'), 5'-bisphosphate nucleotidase 1, anticorps bisphosphate 3'-nucleotidase 1, anticorps BPNT1, anticorps bpnt1.L, anticorps Bpnt1

Sujet: BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity.

Poids moléculaire: 29 kDa (MW of target protein)

Pathways: Inositol Metabolic Process