DENND1A anticorps (N-Term)

N° du produit ABIN631710

Détail du produit anti-DENND1A anticorps

Antigène: DENND1A (DENN/MADD Domain Containing 1A (DENND1A))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DENND1A est non-conjugé

Application: Western Blotting (WB)

Specificité: DENND1 A antibody was raised against the N terminal of DENND1

Purification: Affinity purified

Immunogène: DENND1 A antibody was raised using the N terminal of DENND1 corresponding to a region with amino acids PGVSVHLSVHSYFTVPDTRELPSIPENRNLTEYFVAVDVNNMLHLYASML

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DENND1A Blocking Peptide, catalog no. 33R-7139, is also available for use as a blocking control in assays to test for specificity of this DENND1A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DENND0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DENND1A

Antigène: DENND1A (DENN/MADD Domain Containing 1A (DENND1A))

Autre désignation: DENND1A (DENND1A Produits)

Synonymes: anticorps RGD1307927, anticorps FAM31A, anticorps KIAA1608, anticorps RP11-230L22.3, anticorps 6030446I19Rik, anticorps connecdenn, anticorps fam31a, anticorps DENN domain containing 1A, anticorps DENN/MADD domain containing 1A, anticorps DENN domain-containing protein 1A, anticorps DENN domain containing 1A S homeolog, anticorps Dennd1a, anticorps DENND1A, anticorps dennd1a, anticorps LOC100512328, anticorps dennd1a.S

Sujet: DENND1A may be involved in the clathrin-mediated endocytosis of synaptic vesicles.

Poids moléculaire: 110 kDa (MW of target protein)