ELAC1 anticorps

N° du produit ABIN631711

Détail du produit anti-ELAC1 anticorps

Antigène: ELAC1

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ELAC1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ELAC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSMDVTFLGTGAAYPSPTRGASAVVLRCEGECWLFDCGEGTQTQLMKSQL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ELAC1 Blocking Peptide, catalog no. 33R-6471, is also available for use as a blocking control in assays to test for specificity of this ELAC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELAC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ELAC1

Antigène: ELAC1

Autre désignation: ELAC1 (ELAC1 Produits)

Synonymes: anticorps ELAC1, anticorps zgc:91956, anticorps 2610018O07Rik, anticorps 8430417G19Rik, anticorps D29, anticorps elaC ribonuclease Z 1, anticorps elac1, anticorps ELAC1, anticorps Elac1

Sujet: ELAC1 belongs to the RNase Z family. It is a zinc phosphodiesterase, which displays some tRNA 3'-processing endonuclease activity. The protein is probably involved in tRNA maturation, by removing a 3'-trailer from precursor tRNA.

Poids moléculaire: 40 kDa (MW of target protein)