HP1BP3 anticorps (Middle Region)

N° du produit ABIN631715

Détail du produit anti-HP1BP3 anticorps

Antigène: HP1BP3 (Heterochromatin Protein 1, Binding Protein 3 (HP1BP3))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HP1BP3 est non-conjugé

Application: Western Blotting (WB)

Specificité: HP1 BP3 antibody was raised against the middle region of HP1 P3

Purification: Affinity purified

Immunogène: HP1 BP3 antibody was raised using the middle region of HP1 P3 corresponding to a region with amino acids QYYPKLRVDIRPQLLKNALQRAVERGQLEQITGKGASGTFQLKKSGEKPL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HP1BP3 Blocking Peptide, catalog no. 33R-7796, is also available for use as a blocking control in assays to test for specificity of this HP1BP3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HP0 P3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HP1BP3

Antigène: HP1BP3 (Heterochromatin Protein 1, Binding Protein 3 (HP1BP3))

Autre désignation: HP1BP3 (HP1BP3 Produits)

Synonymes: anticorps HP1-BP74, anticorps Hp1bp74, anticorps heterochromatin protein 1 binding protein 3, anticorps heterochromatin protein 1, binding protein 3, anticorps HP1BP3, anticorps Hp1bp3

Sujet: HP1BP3 is the component of heterochromatin, may be involved in chromatin structure and function.

Poids moléculaire: 61 kDa (MW of target protein)