C22orf9 anticorps (Middle Region)

N° du produit ABIN631718

L’anticorps anti-C22orf9 Polyclonal Lapin est utilisé pour la détection de C22orf9 dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB.

Aperçu rapide pour C22orf9 anticorps (Middle Region) (ABIN631718)

Antigène: C22orf9 (Chromosome 22 Open Reading Frame 9 (C22orf9))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C22orf9 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-C22orf9 anticorps

Épitope: Middle Region

Specificité: C22 ORF9 antibody was raised against the middle region of C22 rf9

Purification: Affinity purified

Immunogène: C22 ORF9 antibody was raised using the middle region of C22 rf9 corresponding to a region with amino acids ERVTSFSTPPTPERNNRPAFFSPSLKRKVPRNRIAEMKKSHSANDSEEFF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C22ORF9 Blocking Peptide, (ABIN938103), is also available for use as a blocking control in assays to test for specificity of this C22ORF9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C22orf9

Antigène: C22orf9 (Chromosome 22 Open Reading Frame 9 (C22orf9))

Autre désignation: C22ORF9

Sujet: The function of C22orf9 has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 46 kDa (MW of target protein)