FBXO27 anticorps (Middle Region)

N° du produit ABIN631723

Cet anticorps Lapin Polyclonal détecte spécifiquement FBXO27 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour FBXO27 anticorps (Middle Region) (ABIN631723)

Antigène: FBXO27 (F-Box Protein 27 (FBXO27))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FBXO27 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FBXO27 anticorps

Épitope: Middle Region

Specificité: FBXO27 antibody was raised against the middle region of FBXO27

Purification: Affinity purified

Immunogène: FBXO27 antibody was raised using the middle region of FBXO27 corresponding to a region with amino acids LDKFSAVPDPIPQWNNNACLHVTHVFSNIKMGVRFVSFEHRGQDTQFWAG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FBXO27 Blocking Peptide, (ABIN940237), is also available for use as a blocking control in assays to test for specificity of this FBXO27 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO27 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FBXO27

Antigène: FBXO27 (F-Box Protein 27 (FBXO27))

Autre désignation: FBXO27

Sujet: Members of the F-box protein family, such as FBXO27, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.Members of the F-box protein family, such as FBXO27, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.

Poids moléculaire: 31 kDa (MW of target protein)