FBXO28 anticorps (Middle Region)

N° du produit ABIN631726

Détail du produit anti-FBXO28 anticorps

Antigène: FBXO28 (F-Box Protein 28 (FBXO28))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FBXO28 est non-conjugé

Application: Western Blotting (WB)

Specificité: FBXO28 antibody was raised against the middle region of FBXO28

Purification: Affinity purified

Immunogène: FBXO28 antibody was raised using the middle region of FBXO28 corresponding to a region with amino acids ELERKLREVMESAVGNSSGSGQNEESPRKRKKATEAIDSLRKSKRLRNRK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FBXO28 Blocking Peptide, catalog no. 33R-2539, is also available for use as a blocking control in assays to test for specificity of this FBXO28 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO28 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FBXO28

Antigène: FBXO28 (F-Box Protein 28 (FBXO28))

Autre désignation: FBXO28 (FBXO28 Produits)

Synonymes: anticorps fd49h06, anticorps wu:fd49h06, anticorps FBXO28, anticorps CENP-30, anticorps Fbx28, anticorps 4833428J17Rik, anticorps 5730505P19Rik, anticorps D1Ertd578e, anticorps mKIAA0483, anticorps F-box protein 28, anticorps F-box protein 28 L homeolog, anticorps fbxo28, anticorps fbxo28.L, anticorps FBXO28, anticorps Fbxo28

Sujet: Members of the F-box protein family, such as FBXO28, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.Members of the F-box protein family, such as FBXO28, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.

Poids moléculaire: 41 kDa (MW of target protein)