RCC2 anticorps (Middle Region)

N° du produit ABIN631742

L’anticorps Lapin Polyclonal anti-RCC2 a été validé pour WB. Il convient pour détecter RCC2 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour RCC2 anticorps (Middle Region) (ABIN631742)

Antigène: RCC2 (Regulator of Chromosome Condensation 2 (RCC2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RCC2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RCC2 anticorps

Épitope: Middle Region

Specificité: RCC2 antibody was raised against the middle region of RCC2

Purification: Affinity purified

Immunogène: RCC2 antibody was raised using the middle region of RCC2 corresponding to a region with amino acids RIRSLACGKSSIIVAADESTISWGPSPTFGELGYGDHKPKSSTAAQEVKT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RCC2 Blocking Peptide, (ABIN5615814), is also available for use as a blocking control in assays to test for specificity of this RCC2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RCC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RCC2

Antigène: RCC2 (Regulator of Chromosome Condensation 2 (RCC2))

Autre désignation: RCC2

Sujet: RCC2 is required for completion of mitosis and cytokinesis. RCC2 may function as a guanine nucleotide exchange factor for the small GTPase RAC1.

Poids moléculaire: 56 kDa (MW of target protein)