SAE1 anticorps (N-Term)

N° du produit ABIN631747

Cet anticorps Lapin Polyclonal détecte spécifiquement SAE1 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour SAE1 anticorps (N-Term) (ABIN631747)

Antigène: SAE1 (SUMO1 Activating Enzyme Subunit 1 (SAE1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SAE1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SAE1 anticorps

Épitope: N-Term

Specificité: SAE1 antibody was raised against the N terminal of SAE1

Purification: Affinity purified

Immunogène: SAE1 antibody was raised using the N terminal of SAE1 corresponding to a region with amino acids MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SAE1 Blocking Peptide, (ABIN5615993), is also available for use as a blocking control in assays to test for specificity of this SAE1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SAE1

Antigène: SAE1 (SUMO1 Activating Enzyme Subunit 1 (SAE1))

Autre désignation: SAE1

Sujet: Posttranslational modification of proteins by the addition of the small protein SUMO, or sumoylation, regulates protein structure and intracellular localization. SAE1 and UBA2 form a heterodimer that functions as a SUMO-activating enzyme for the sumoylation of proteins.

Poids moléculaire: 38 kDa (MW of target protein)