SAE1 anticorps (N-Term)

N° du produit ABIN631747

Détail du produit anti-SAE1 anticorps

Antigène: SAE1 (SUMO1 Activating Enzyme Subunit 1 (SAE1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SAE1 est non-conjugé

Application: Western Blotting (WB)

Specificité: SAE1 antibody was raised against the N terminal of SAE1

Purification: Affinity purified

Immunogène: SAE1 antibody was raised using the N terminal of SAE1 corresponding to a region with amino acids MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SAE1 Blocking Peptide, catalog no. 33R-6581, is also available for use as a blocking control in assays to test for specificity of this SAE1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SAE1

Antigène: SAE1 (SUMO1 Activating Enzyme Subunit 1 (SAE1))

Autre désignation: SAE1 (SAE1 Produits)

Synonymes: anticorps AOS1, anticorps HSPC140, anticorps SUA1, anticorps UBLE1A, anticorps 2400010M20Rik, anticorps 2610044L12Rik, anticorps AL033372, anticorps AW743391, anticorps D7Ertd177e, anticorps Sua1, anticorps Uble1a, anticorps Aos1p, anticorps Sua1p, anticorps aos, anticorps sae2a, anticorps uble1a, anticorps wu:fa28b04, anticorps zgc:86633, anticorps SUMO1 activating enzyme subunit 1, anticorps SUMO1 activating enzyme subunit 1 L homeolog, anticorps SAE1, anticorps Sae1, anticorps sae1.L, anticorps sae1

Sujet: Posttranslational modification of proteins by the addition of the small protein SUMO, or sumoylation, regulates protein structure and intracellular localization. SAE1 and UBA2 form a heterodimer that functions as a SUMO-activating enzyme for the sumoylation of proteins.

Poids moléculaire: 38 kDa (MW of target protein)