GPN2 anticorps (Middle Region)

N° du produit ABIN631748

L’anticorps Lapin Polyclonal anti-GPN2 a été validé pour WB. Il convient pour détecter GPN2 dans des échantillons de Humain.

Aperçu rapide pour GPN2 anticorps (Middle Region) (ABIN631748)

Antigène: GPN2 (GPN-Loop GTPase 2 (GPN2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GPN2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GPN2 anticorps

Épitope: Middle Region

Specificité: GPN2 antibody was raised against the middle region of GPN2

Purification: Affinity purified

Immunogène: GPN2 antibody was raised using the middle region of GPN2 corresponding to a region with amino acids VLQAVDKANGYCFRAQEQRSLEAMMSAAMGADFHFSSTLGIQEKYLAPSN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GPN2 Blocking Peptide, (ABIN5613831), is also available for use as a blocking control in assays to test for specificity of this GPN2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GPN2

Antigène: GPN2 (GPN-Loop GTPase 2 (GPN2))

Autre désignation: GPN2

Sujet: The function of GPN protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 34 kDa (MW of target protein)