Tiparp anticorps

N° du produit ABIN631753

Détail du produit anti-Tiparp anticorps

Antigène: Tiparp (TCDD-Inducible Poly(ADP-Ribose) Polymerase (Tiparp))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Tiparp est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: TIPARP antibody was raised using a synthetic peptide corresponding to a region with amino acids LKTCFKKKDQKRLGTGTLRSLRPILNTLLESGSLDGVFRSRNQSTDENSL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TIPARP Blocking Peptide, catalog no. 33R-5107, is also available for use as a blocking control in assays to test for specificity of this TIPARP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TIPARP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Tiparp

Antigène: Tiparp (TCDD-Inducible Poly(ADP-Ribose) Polymerase (Tiparp))

Autre désignation: TIPARP (Tiparp Produits)

Synonymes: anticorps TIPARP, anticorps fc03g05, anticorps sb:cb841, anticorps si:dkey-33k14.4, anticorps wu:fc03g05, anticorps zgc:153056, anticorps ddf1, anticorps parp7, anticorps parp-1, anticorps parp-7, anticorps ARTD14, anticorps PARP7, anticorps pART14, anticorps AW558171, anticorps RM1, anticorps TCDD inducible poly(ADP-ribose) polymerase, anticorps TCDD-inducible poly(ADP-ribose) polymerase, anticorps TCDD-inducible poly [ADP-ribose] polymerase, anticorps TIPARP, anticorps tiparp, anticorps LOC100018933, anticorps Tiparp

Sujet: TIPARP is a poly [ADP-ribose] polymerase using NAD+ as a substrate to transfer ADP-ribose onto glutamic acid residues of a protein acceptor, repeated rounds of ADP-ribosylation leads to the formation of poly(ADPribose) chains on the protein, thereby altering the function of the target protein. TIPARP may play a role in the adaptative response to chemical exposure (TCDD) and thereby mediates certain effects of the chemicals.

Poids moléculaire: 76 kDa (MW of target protein)

Pathways: Platelet-derived growth Factor Receptor Signaling