Tiparp anticorps

N° du produit ABIN631753

Cet anticorps Lapin Polyclonal détecte spécifiquement Tiparp dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour Tiparp anticorps (ABIN631753)

Antigène: Tiparp (TCDD-Inducible Poly(ADP-Ribose) Polymerase (Tiparp))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Tiparp est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Tiparp anticorps

Purification: Affinity purified

Immunogène: TIPARP antibody was raised using a synthetic peptide corresponding to a region with amino acids LKTCFKKKDQKRLGTGTLRSLRPILNTLLESGSLDGVFRSRNQSTDENSL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TIPARP Blocking Peptide, (ABIN940493), is also available for use as a blocking control in assays to test for specificity of this TIPARP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TIPARP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Tiparp

Antigène: Tiparp (TCDD-Inducible Poly(ADP-Ribose) Polymerase (Tiparp))

Autre désignation: TIPARP

Sujet: TIPARP is a poly [ADP-ribose] polymerase using NAD+ as a substrate to transfer ADP-ribose onto glutamic acid residues of a protein acceptor, repeated rounds of ADP-ribosylation leads to the formation of poly(ADPribose) chains on the protein, thereby altering the function of the target protein. TIPARP may play a role in the adaptative response to chemical exposure (TCDD) and thereby mediates certain effects of the chemicals.

Poids moléculaire: 76 kDa (MW of target protein)

Pathways: Platelet-derived growth Factor Receptor Signaling