ELAC1 anticorps
-
- Antigène Voir toutes ELAC1 Anticorps
- ELAC1
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ELAC1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ELAC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LFHRIPSFGFSVVEKKRPGKLNAQKLKDLGVPPGPAYGKLKNGISVVLEN
- Top Product
- Discover our top product ELAC1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ELAC1 Blocking Peptide, catalog no. 33R-4938, is also available for use as a blocking control in assays to test for specificity of this ELAC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELAC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ELAC1
- Autre désignation
- ELAC1 (ELAC1 Produits)
- Synonymes
- anticorps ELAC1, anticorps zgc:91956, anticorps 2610018O07Rik, anticorps 8430417G19Rik, anticorps D29, anticorps elaC ribonuclease Z 1, anticorps elac1, anticorps ELAC1, anticorps Elac1
- Sujet
- ELAC1 belongs to the RNase Z family. It is a zinc phosphodiesterase, which displays some tRNA 3'-processing endonuclease activity. The protein is probably involved in tRNA maturation, by removing a 3'-trailer from precursor tRNA.
- Poids moléculaire
- 40 kDa (MW of target protein)
-