VARS anticorps (Middle Region)

N° du produit ABIN631756

Cet anticorps Lapin Polyclonal détecte spécifiquement VARS dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour VARS anticorps (Middle Region) (ABIN631756)

Antigène: VARS (Valyl-tRNA Synthetase (VARS))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp VARS est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-VARS anticorps

Épitope: Middle Region

Specificité: VARS antibody was raised against the middle region of VARS

Purification: Affinity purified

Immunogène: VARS antibody was raised using the middle region of VARS corresponding to a region with amino acids VFDEFVDMDFGTGAVKITPAHDQNDYEVGQRHGLEAISIMDSRGALINVP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

VARS Blocking Peptide, (ABIN5616945), is also available for use as a blocking control in assays to test for specificity of this VARS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VARS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur VARS

Antigène: VARS (Valyl-tRNA Synthetase (VARS))

Autre désignation: VARS

Sujet: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. VARS belongs to class-I aminoacyl-tRNA synthetase family and is located in the class III region of the major histocompatibility complex.

Poids moléculaire: 140 kDa (MW of target protein)