VARS anticorps (Middle Region)

N° du produit ABIN631756

Détail du produit anti-VARS anticorps

Antigène: VARS (Valyl-tRNA Synthetase (VARS))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp VARS est non-conjugé

Application: Western Blotting (WB)

Specificité: VARS antibody was raised against the middle region of VARS

Purification: Affinity purified

Immunogène: VARS antibody was raised using the middle region of VARS corresponding to a region with amino acids VFDEFVDMDFGTGAVKITPAHDQNDYEVGQRHGLEAISIMDSRGALINVP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

VARS Blocking Peptide, catalog no. 33R-9521, is also available for use as a blocking control in assays to test for specificity of this VARS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VARS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur VARS

Antigène: VARS (Valyl-tRNA Synthetase (VARS))

Autre désignation: VARS (VARS Produits)

Synonymes: anticorps G7A, anticorps VARS1, anticorps VARS2, anticorps VARS, anticorps Bat6, anticorps D17H6S56E, anticorps G7a, anticorps Vars2, anticorps vars1, anticorps vars2, anticorps CHUNP6879, anticorps im:7137378, anticorps wu:fb07a11, anticorps wu:fb07d10, anticorps TrsVal, anticorps BEST:LD45671, anticorps CG4062, anticorps Dmel\\CG4062, anticorps VRS, anticorps ValRS, anticorps l(2)03531, anticorps l(2)rI255, anticorps ld45671, anticorps ECK4251, anticorps JW4215, anticorps val-act, anticorps T5E21.11, anticorps T5E21_11, anticorps TWIN 2, anticorps VALRS, anticorps VALYL TRNA SYNTHETASE, anticorps valyl-tRNA synthetase, anticorps Valyl-tRNA synthetase, anticorps valyl-tRNA synthetase S homeolog, anticorps hypothetical protein, anticorps valyl-tRNA synthetase 2, mitochondrial, anticorps valyl-tRNA synthetase / valine-tRNA ligase (VALRS), anticorps VARS, anticorps Vars, anticorps vars, anticorps ValRS, anticorps vars.S, anticorps MW0078, anticorps Pnap_3169, anticorps valS, anticorps Fnod_0343, anticorps Cyan7425_1070, anticorps Tola_0553, anticorps Slip_0680, anticorps Astex_3136, anticorps ML5_3395, anticorps VARS2, anticorps TWN2

Sujet: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. VARS belongs to class-I aminoacyl-tRNA synthetase family and is located in the class III region of the major histocompatibility complex.

Poids moléculaire: 140 kDa (MW of target protein)