SPATA17 anticorps (C-Term)
-
- Antigène Tous les produits SPATA17
- SPATA17 (Spermatogenesis Associated 17 (SPATA17))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SPATA17 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SPATA17 antibody was raised against the C terminal of SPATA17
- Purification
- Affinity purified
- Immunogène
- SPATA17 antibody was raised using the C terminal of SPATA17 corresponding to a region with amino acids NMFLPFSSYHKNEKYIPSMHLSSKYGPISYKEQFRSENPKKWICDKDFQT
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SPATA17 Blocking Peptide, catalog no. 33R-6793, is also available for use as a blocking control in assays to test for specificity of this SPATA17 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPATA17 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SPATA17 (Spermatogenesis Associated 17 (SPATA17))
- Autre désignation
- SPATA17 (SPATA17 Produits)
- Synonymes
- anticorps IQCH, anticorps MSRG-11, anticorps MSRG11, anticorps RP11-144C20.1, anticorps 1700065F16Rik, anticorps 4930504I07Rik, anticorps 4930513F16Rik, anticorps spermatogenesis associated 17, anticorps SPATA17, anticorps Spata17
- Sujet
- SPATA17 contains 3 IQ domains. The function of the SPATA17 protein is not known.
- Poids moléculaire
- 43 kDa (MW of target protein)
-