SPATA17 anticorps (C-Term)

N° du produit ABIN631760

Détail du produit anti-SPATA17 anticorps

Antigène: SPATA17 (Spermatogenesis Associated 17 (SPATA17))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SPATA17 est non-conjugé

Application: Western Blotting (WB)

Specificité: SPATA17 antibody was raised against the C terminal of SPATA17

Purification: Affinity purified

Immunogène: SPATA17 antibody was raised using the C terminal of SPATA17 corresponding to a region with amino acids NMFLPFSSYHKNEKYIPSMHLSSKYGPISYKEQFRSENPKKWICDKDFQT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SPATA17 Blocking Peptide, catalog no. 33R-6793, is also available for use as a blocking control in assays to test for specificity of this SPATA17 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPATA17 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SPATA17

Antigène: SPATA17 (Spermatogenesis Associated 17 (SPATA17))

Autre désignation: SPATA17 (SPATA17 Produits)

Synonymes: anticorps IQCH, anticorps MSRG-11, anticorps MSRG11, anticorps RP11-144C20.1, anticorps 1700065F16Rik, anticorps 4930504I07Rik, anticorps 4930513F16Rik, anticorps spermatogenesis associated 17, anticorps SPATA17, anticorps Spata17

Sujet: SPATA17 contains 3 IQ domains. The function of the SPATA17 protein is not known.

Poids moléculaire: 43 kDa (MW of target protein)