PRR19 anticorps (N-Term)

N° du produit ABIN631767

Cet anticorps anti-PRR19 est un anticorps Lapin Polyclonal détectant PRR19 dans WB. Adapté pour Humain.

Aperçu rapide pour PRR19 anticorps (N-Term) (ABIN631767)

Antigène: PRR19 (Proline Rich 19 (PRR19))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRR19 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PRR19 anticorps

Épitope: N-Term

Specificité: MGC70924 antibody was raised against the N terminal Of Mgc70924

Purification: Affinity purified

Immunogène: MGC70924 antibody was raised using the N terminal Of Mgc70924 corresponding to a region with amino acids MDTQGPVSQPFQQPEKPGRVRRRKTRRERNKALVGSRRPLAHHDPPVAIR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MGC70924 Blocking Peptide, (ABIN5614756), is also available for use as a blocking control in assays to test for specificity of this MGC70924 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC70924 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRR19

Antigène: PRR19 (Proline Rich 19 (PRR19))

Autre désignation: MGC70924

Sujet: The function of MGC70924 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 39 kDa (MW of target protein)